PDZD11 (NM_016484) Human Recombinant Protein
CAT#: TP301049
Recombinant protein of human PDZ domain containing 11 (PDZD11), 20 µg
View other "PDZD11" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201049 protein sequence
Red=Cloning site Green=Tags(s) MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQL GIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057568 |
Locus ID | 51248 |
UniProt ID | Q5EBL8 |
Refseq Size | 1246 |
Cytogenetics | Xq13.1 |
Refseq ORF | 420 |
Synonyms | AIPP1; PDZK11; PISP |
Summary | Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10-binding protein TSPAN33.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413926 | PDZD11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413926 | Transient overexpression lysate of PDZ domain containing 11 (PDZD11) |
CNY 3080.00 |
|
PH301049 | PDZD11 MS Standard C13 and N15-labeled recombinant protein (NP_057568) |
CNY 19520.00 |