SSR3 (NM_007107) Human Mass Spec Standard
CAT#: PH301079
SSR3 MS Standard C13 and N15-labeled recombinant protein (NP_009038)
View other "SSR3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SSR3 MS Standard C13 and N15-labeled recombinant protein (NP_009038) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201079 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC201079 protein sequence
Red=Cloning site Green=Tags(s) MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVST YLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFY NNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009038 |
RefSeq Size | 3734 |
RefSeq ORF | 555 |
Synonyms | TRAPG |
Locus ID | 6747 |
Cytogenetics | 3q25.31 |
Summary | The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. This gene encodes the gamma subunit, which is predicted to span the membrane four times. [provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402091 | SSR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402091 | Transient overexpression lysate of signal sequence receptor, gamma (translocon-associated protein gamma) (SSR3) |
CNY 3080.00 |
|
TP301079 | Recombinant protein of human signal sequence receptor, gamma (translocon-associated protein gamma) (SSR3), 20 µg |
CNY 2900.00 |