SSR3 (NM_007107) Human Recombinant Protein
CAT#: TP301079
Recombinant protein of human signal sequence receptor, gamma (translocon-associated protein gamma) (SSR3), 20 µg
View other "SSR3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201079 protein sequence
Red=Cloning site Green=Tags(s) MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVST YLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFY NNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 20.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009038 |
| Locus ID | 6747 |
| UniProt ID | Q9UNL2 |
| Refseq Size | 3734 |
| Cytogenetics | 3q25.31 |
| Refseq ORF | 555 |
| Synonyms | TRAPG |
| Summary | The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. This gene encodes the gamma subunit, which is predicted to span the membrane four times. [provided by RefSeq, Aug 2010] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402091 | SSR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402091 | Transient overexpression lysate of signal sequence receptor, gamma (translocon-associated protein gamma) (SSR3) |
CNY 3080.00 |
|
| PH301079 | SSR3 MS Standard C13 and N15-labeled recombinant protein (NP_009038) |
CNY 19520.00 |


