Tropomodulin 1 (TMOD1) (NM_003275) Human Mass Spec Standard
CAT#: PH301134
TMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_003266)
View other "Tropomodulin 1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | TMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_003266) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201134 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC201134 protein sequence
Red=Cloning site Green=Tags(s) MSYRRELEKYRDLDEDKILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP IIPKCRSGV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003266 |
RefSeq Size | 3352 |
RefSeq ORF | 1077 |
Synonyms | D9S57E; ETMOD; TMOD |
Locus ID | 7111 |
Cytogenetics | 9q22.33 |
Summary | This gene encodes a member of the tropomodulin family. The encoded protein is an actin-capping protein that regulates tropomyosin by binding to its N-terminus, inhibiting depolymerization and elongation of the pointed end of actin filaments and thereby influencing the structure of the erythrocyte membrane skeleton. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418797 | TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431319 | TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418797 | Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 1 |
CNY 3080.00 |
|
LY431319 | Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 2 |
CNY 3080.00 |
|
TP301134 | Recombinant protein of human tropomodulin 1 (TMOD1), 20 µg |
CNY 2900.00 |
|
TP328291 | Recombinant protein of human tropomodulin 1 (TMOD1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Tropomodulin 1产品