Tropomodulin 1 (TMOD1) (NM_001166116) Human Recombinant Protein
CAT#: TP328291
Recombinant protein of human tropomodulin 1 (TMOD1), transcript variant 2, 20 µg
View other "Tropomodulin 1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228291 representing NM_001166116
Red=Cloning site Green=Tags(s) MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP IIPKCRSGV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 40.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001159588 |
| Locus ID | 7111 |
| UniProt ID | P28289 |
| Cytogenetics | 9q22.33 |
| Refseq ORF | 1077 |
| Synonyms | D9S57E; ETMOD; TMOD |
| Summary | This gene encodes a member of the tropomodulin family. The encoded protein is an actin-capping protein that regulates tropomyosin by binding to its N-terminus, inhibiting depolymerization and elongation of the pointed end of actin filaments and thereby influencing the structure of the erythrocyte membrane skeleton. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418797 | TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431319 | TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418797 | Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 1 |
CNY 3080.00 |
|
| LY431319 | Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 2 |
CNY 3080.00 |
|
| PH301134 | TMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_003266) |
CNY 19520.00 |
|
| TP301134 | Recombinant protein of human tropomodulin 1 (TMOD1), 20 µg |
CNY 2900.00 |
其它Tropomodulin 1产品
