MRPS25 (NM_022497) Human Mass Spec Standard
CAT#: PH301353
MRPS25 MS Standard C13 and N15-labeled recombinant protein (NP_071942)
View other "MRPS25" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MRPS25 MS Standard C13 and N15-labeled recombinant protein (NP_071942) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201353 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC201353 protein sequence
Red=Cloning site Green=Tags(s) MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNM TPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECI CEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071942 |
| RefSeq Size | 4574 |
| RefSeq ORF | 519 |
| Synonyms | COXPD50; MRP-S25; RPMS25 |
| Locus ID | 64432 |
| Cytogenetics | 3p25.1 |
| Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411645 | MRPS25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411645 | Transient overexpression lysate of mitochondrial ribosomal protein S25 (MRPS25), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP301353 | Recombinant protein of human mitochondrial ribosomal protein S25 (MRPS25), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
