MRPS25 (NM_022497) Human Recombinant Protein
CAT#: TP301353
Recombinant protein of human mitochondrial ribosomal protein S25 (MRPS25), nuclear gene encoding mitochondrial protein, 20 µg
View other "MRPS25" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201353 protein sequence
Red=Cloning site Green=Tags(s) MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNM TPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECI CEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_071942 |
| Locus ID | 64432 |
| UniProt ID | P82663 |
| Refseq Size | 4574 |
| Cytogenetics | 3p25.1 |
| Refseq ORF | 519 |
| Synonyms | COXPD50; MRP-S25; RPMS25 |
| Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411645 | MRPS25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411645 | Transient overexpression lysate of mitochondrial ribosomal protein S25 (MRPS25), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH301353 | MRPS25 MS Standard C13 and N15-labeled recombinant protein (NP_071942) |
CNY 19520.00 |
