RITA (RITA1) (NM_032848) Human Mass Spec Standard
CAT#: PH301409
C12orf52 MS Standard C13 and N15-labeled recombinant protein (NP_116237)
View other "RITA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C12orf52 MS Standard C13 and N15-labeled recombinant protein (NP_116237) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201409 |
| Predicted MW | 28.4 kDa |
| Protein Sequence |
>RC201409 representing NM_032848
Red=Cloning site Green=Tags(s) MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEA SKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRAL LWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPST GHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116237 |
| RefSeq Size | 1775 |
| RefSeq ORF | 807 |
| Synonyms | C12orf52; RITA |
| Locus ID | 84934 |
| Cytogenetics | 12q24.13 |
| Summary | Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409884 | RITA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409884 | Transient overexpression lysate of chromosome 12 open reading frame 52 (C12orf52) |
CNY 3080.00 |
|
| TP301409 | Recombinant protein of human chromosome 12 open reading frame 52 (C12orf52), 20 µg |
CNY 2900.00 |
