RITA (RITA1) (NM_032848) Human Recombinant Protein
CAT#: TP301409
Recombinant protein of human chromosome 12 open reading frame 52 (C12orf52), 20 µg
View other "RITA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201409 representing NM_032848
Red=Cloning site Green=Tags(s) MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEA SKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRAL LWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPST GHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116237 |
| Locus ID | 84934 |
| UniProt ID | Q96K30 |
| Refseq Size | 1775 |
| Cytogenetics | 12q24.13 |
| Refseq ORF | 807 |
| Synonyms | C12orf52; RITA |
| Summary | Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409884 | RITA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409884 | Transient overexpression lysate of chromosome 12 open reading frame 52 (C12orf52) |
CNY 3080.00 |
|
| PH301409 | C12orf52 MS Standard C13 and N15-labeled recombinant protein (NP_116237) |
CNY 19520.00 |
