GRCC10 (C12orf57) (NM_138425) Human Mass Spec Standard
CAT#: PH301441
C12orf57 MS Standard C13 and N15-labeled recombinant protein (NP_612434)
View other "GRCC10" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C12orf57 MS Standard C13 and N15-labeled recombinant protein (NP_612434) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201441 |
Predicted MW | 13.2 kDa |
Protein Sequence |
>RC201441 protein sequence
Red=Cloning site Green=Tags(s) MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYG FSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612434 |
RefSeq Size | 794 |
RefSeq ORF | 378 |
Synonyms | C10; GRCC10 |
Locus ID | 113246 |
Cytogenetics | 12p13.31 |
Summary | This gene is ubiquitously expressed in human tissues. It is required for development of the human corpus callosum. Mutations in this gene are associated with Temtamy syndrome (TEMTYS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408681 | C12orf57 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408681 | Transient overexpression lysate of chromosome 12 open reading frame 57 (C12orf57) |
CNY 3080.00 |
|
TP301441 | Recombinant protein of human chromosome 12 open reading frame 57 (C12orf57), 20 µg |
CNY 2900.00 |