GRCC10 (C12orf57) (NM_138425) Human Recombinant Protein
CAT#: TP301441
Recombinant protein of human chromosome 12 open reading frame 57 (C12orf57), 20 µg
View other "GRCC10" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201441 protein sequence
Red=Cloning site Green=Tags(s) MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYG FSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612434 |
Locus ID | 113246 |
UniProt ID | Q99622 |
Refseq Size | 794 |
Cytogenetics | 12p13.31 |
Refseq ORF | 378 |
Synonyms | C10; GRCC10 |
Summary | This gene is ubiquitously expressed in human tissues. It is required for development of the human corpus callosum. Mutations in this gene are associated with Temtamy syndrome (TEMTYS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408681 | C12orf57 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408681 | Transient overexpression lysate of chromosome 12 open reading frame 57 (C12orf57) |
CNY 3080.00 |
|
PH301441 | C12orf57 MS Standard C13 and N15-labeled recombinant protein (NP_612434) |
CNY 19520.00 |