RAB10 (NM_016131) Human Mass Spec Standard
CAT#: PH301464
RAB10 MS Standard C13 and N15-labeled recombinant protein (NP_057215)
View other "RAB10" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB10 MS Standard C13 and N15-labeled recombinant protein (NP_057215) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201464 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC201464 protein sequence
Red=Cloning site Green=Tags(s) MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057215 |
| RefSeq Size | 3785 |
| RefSeq ORF | 600 |
| Locus ID | 10890 |
| Cytogenetics | 2p23.3 |
| Summary | RAB10 belongs to the RAS (see HRAS; MIM 190020) superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking (Bao et al., 1998 [PubMed 9918381]).[supplied by OMIM, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414160 | RAB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414160 | Transient overexpression lysate of RAB10, member RAS oncogene family (RAB10) |
CNY 3080.00 |
|
| TP301464 | Recombinant protein of human RAB10, member RAS oncogene family (RAB10), 20 µg |
CNY 2900.00 |
