STAP2 (NM_001013841) Human Mass Spec Standard
CAT#: PH301518
STAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001013863)
View other "STAP2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | STAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001013863) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201518 |
| Predicted MW | 44.9 kDa |
| Protein Sequence |
>RC201518 protein sequence
Red=Cloning site Green=Tags(s) MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEK LTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLA KEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREG PKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAP CTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPK PPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001013863 |
| RefSeq Size | 1419 |
| RefSeq ORF | 1209 |
| Synonyms | BKS |
| Locus ID | 55620 |
| Cytogenetics | 19p13.3 |
| Summary | This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413599 | STAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423042 | STAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413599 | Transient overexpression lysate of signal transducing adaptor family member 2 (STAP2), transcript variant 1 |
CNY 4840.00 |
|
| LY423042 | Transient overexpression lysate of signal transducing adaptor family member 2 (STAP2), transcript variant 2 |
CNY 3080.00 |
|
| TP301518 | Recombinant protein of human signal transducing adaptor family member 2 (STAP2), transcript variant 2, 20 µg |
CNY 2900.00 |
