STAP2 (NM_001013841) Human Recombinant Protein
CAT#: TP301518
Recombinant protein of human signal transducing adaptor family member 2 (STAP2), transcript variant 2, 20 µg
View other "STAP2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 6281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201518 protein sequence
Red=Cloning site Green=Tags(s) MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEK LTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLA KEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREG PKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAP CTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPK PPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001013863 |
Locus ID | 55620 |
UniProt ID | Q9UGK3 |
Refseq Size | 1419 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1209 |
Synonyms | BKS |
Summary | This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413599 | STAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC423042 | STAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413599 | Transient overexpression lysate of signal transducing adaptor family member 2 (STAP2), transcript variant 1 |
CNY 4840.00 |
|
LY423042 | Transient overexpression lysate of signal transducing adaptor family member 2 (STAP2), transcript variant 2 |
CNY 3080.00 |
|
PH301518 | STAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001013863) |
CNY 19520.00 |