PDLIM1 (NM_020992) Human Mass Spec Standard
CAT#: PH301674
PDLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_066272)
View other "PDLIM1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PDLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_066272) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201674 |
| Predicted MW | 36.1 kDa |
| Protein Sequence |
>RC201674 protein sequence
Red=Cloning site Green=Tags(s) MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRI KGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVI TNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPP KQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRH PECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066272 |
| RefSeq Size | 1598 |
| RefSeq ORF | 987 |
| Synonyms | CLIM1; CLP-36; CLP36; hCLIM1; HEL-S-112 |
| Locus ID | 9124 |
| Cytogenetics | 10q23.33 |
| Summary | This gene encodes a member of the enigma protein family. The protein contains two protein interacting domains, a PDZ domain at the amino terminal end and one to three LIM domains at the carboxyl terminal. It is a cytoplasmic protein associated with the cytoskeleton. The protein may function as an adapter to bring other LIM-interacting proteins to the cytoskeleton. Pseudogenes associated with this gene are located on chromosomes 3, 14 and 17. [provided by RefSeq, Oct 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402823 | PDLIM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402823 | Transient overexpression lysate of PDZ and LIM domain 1 (PDLIM1) |
CNY 3080.00 |
|
| TP301674 | Recombinant protein of human PDZ and LIM domain 1 (PDLIM1), 20 µg |
CNY 2900.00 |
