PDLIM1 (NM_020992) Human Recombinant Protein
CAT#: TP301674
Recombinant protein of human PDZ and LIM domain 1 (PDLIM1), 20 µg
View other "PDLIM1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201674 protein sequence
Red=Cloning site Green=Tags(s) MTTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRI KGCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVI TNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPP KQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRH PECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTVFPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066272 |
| Locus ID | 9124 |
| UniProt ID | O00151 |
| Refseq Size | 1598 |
| Cytogenetics | 10q23.33 |
| Refseq ORF | 987 |
| Synonyms | CLIM1; CLP-36; CLP36; hCLIM1; HEL-S-112 |
| Summary | This gene encodes a member of the enigma protein family. The protein contains two protein interacting domains, a PDZ domain at the amino terminal end and one to three LIM domains at the carboxyl terminal. It is a cytoplasmic protein associated with the cytoskeleton. The protein may function as an adapter to bring other LIM-interacting proteins to the cytoskeleton. Pseudogenes associated with this gene are located on chromosomes 3, 14 and 17. [provided by RefSeq, Oct 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402823 | PDLIM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402823 | Transient overexpression lysate of PDZ and LIM domain 1 (PDLIM1) |
CNY 3080.00 |
|
| PH301674 | PDLIM1 MS Standard C13 and N15-labeled recombinant protein (NP_066272) |
CNY 19520.00 |
