BCL7B (NM_001707) Human Mass Spec Standard
CAT#: PH301696
BCL7B MS Standard C13 and N15-labeled recombinant protein (NP_001698)
View other "BCL7B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | BCL7B MS Standard C13 and N15-labeled recombinant protein (NP_001698) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201696 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC201696 protein sequence
Red=Cloning site Green=Tags(s) MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREP NGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLG QEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001698 |
| RefSeq Size | 1729 |
| RefSeq ORF | 606 |
| Locus ID | 9275 |
| Cytogenetics | 7q11.23 |
| Summary | This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. This gene is highly conserved from C. elegans to human. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419788 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433989 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419788 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B) |
CNY 3080.00 |
|
| LY433989 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2 |
CNY 3080.00 |
|
| TP301696 | Recombinant protein of human B-cell CLL/lymphoma 7B (BCL7B), 20 µg |
CNY 2900.00 |
|
| TP330990 | Purified recombinant protein of Homo sapiens B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2, 20 µg |
CNY 2900.00 |
