BCL7B (NM_001197244) Human Recombinant Protein
CAT#: TP330990
Purified recombinant protein of Homo sapiens B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2, 20 µg
View other "BCL7B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC230990 representing NM_001197244
Red=Cloning site Green=Tags(s) MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREP NGFPSDASANSSLLLEFQEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQ TASES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16.5 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001184173 |
| Locus ID | 9275 |
| UniProt ID | Q9BQE9 |
| Cytogenetics | 7q11.23 |
| Refseq ORF | 435 |
| Summary | This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. This gene is highly conserved from C. elegans to human. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419788 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433989 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419788 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B) |
CNY 3080.00 |
|
| LY433989 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2 |
CNY 3080.00 |
|
| PH301696 | BCL7B MS Standard C13 and N15-labeled recombinant protein (NP_001698) |
CNY 19520.00 |
|
| TP301696 | Recombinant protein of human B-cell CLL/lymphoma 7B (BCL7B), 20 µg |
CNY 2900.00 |
