UDP glucose dehydrogenase (UGDH) (NM_003359) Human Mass Spec Standard
CAT#: PH302132
UGDH MS Standard C13 and N15-labeled recombinant protein (NP_003350)
View other "UDP glucose dehydrogenase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | UGDH MS Standard C13 and N15-labeled recombinant protein (NP_003350) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202132 |
| Predicted MW | 55 kDa |
| Protein Sequence |
>RC202132 protein sequence
Red=Cloning site Green=Tags(s) MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLF FSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESI RRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILT TNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKD VLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSS IYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNK KPKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003350 |
| RefSeq Size | 3195 |
| RefSeq ORF | 1482 |
| Synonyms | DEE84; EIEE84; GDH; UDP-GlcDH; UDPGDH; UGD |
| Locus ID | 7358 |
| Cytogenetics | 4p14 |
| Summary | The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010] |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Ascorbate and aldarate metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Starch and sucrose metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401149 | UGDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433062 | UGDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401149 | Transient overexpression lysate of UDP-glucose dehydrogenase (UGDH) |
CNY 3080.00 |
|
| LY433062 | Transient overexpression lysate of UDP-glucose 6-dehydrogenase (UGDH), transcript variant 2 |
CNY 3080.00 |
|
| TP302132 | Recombinant protein of human UDP-glucose dehydrogenase (UGDH), 20 µg |
CNY 2900.00 |
其它UDP glucose dehydrogenase产品
