UDP glucose dehydrogenase (UGDH) (NM_003359) Human Recombinant Protein
CAT#: TP302132
Recombinant protein of human UDP-glucose dehydrogenase (UGDH), 20 µg
View other "UDP glucose dehydrogenase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202132 protein sequence
Red=Cloning site Green=Tags(s) MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLF FSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESI RRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILT TNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKD VLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSS IYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNK KPKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003350 |
| Locus ID | 7358 |
| UniProt ID | O60701 |
| Refseq Size | 3195 |
| Cytogenetics | 4p14 |
| Refseq ORF | 1482 |
| Synonyms | DEE84; EIEE84; GDH; UDP-GlcDH; UDPGDH; UGD |
| Summary | The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010] |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Ascorbate and aldarate metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Starch and sucrose metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401149 | UGDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433062 | UGDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401149 | Transient overexpression lysate of UDP-glucose dehydrogenase (UGDH) |
CNY 3080.00 |
|
| LY433062 | Transient overexpression lysate of UDP-glucose 6-dehydrogenase (UGDH), transcript variant 2 |
CNY 3080.00 |
|
| PH302132 | UGDH MS Standard C13 and N15-labeled recombinant protein (NP_003350) |
CNY 19520.00 |
其它UDP glucose dehydrogenase产品
