MED30 (NM_080651) Human Mass Spec Standard
CAT#: PH302305
MED30 MS Standard C13 and N15-labeled recombinant protein (NP_542382)
View other "MED30" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MED30 MS Standard C13 and N15-labeled recombinant protein (NP_542382) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202305 |
| Predicted MW | 20.3 kDa |
| Protein Sequence |
>RC202305 protein sequence
Red=Cloning site Green=Tags(s) MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGT YQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERR EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_542382 |
| RefSeq Size | 994 |
| RefSeq ORF | 534 |
| Synonyms | MED30S; THRAP6; TRAP25 |
| Locus ID | 90390 |
| Cytogenetics | 8q24.11 |
| Summary | The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 [PubMed 11909976]).[supplied by OMIM, Nov 2010] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409121 | MED30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409121 | Transient overexpression lysate of mediator complex subunit 30 (MED30) |
CNY 3080.00 |
|
| TP302305 | Recombinant protein of human mediator complex subunit 30 (MED30), 20 µg |
CNY 2900.00 |
