Optineurin (OPTN) (NM_001008211) Human Mass Spec Standard
CAT#: PH302470
OPTN MS Standard C13 and N15-labeled recombinant protein (NP_001008212)
View other "Optineurin" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | OPTN MS Standard C13 and N15-labeled recombinant protein (NP_001008212) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202470 |
| Predicted MW | 65.9 kDa |
| Protein Sequence |
>RC202470 protein sequence
Red=Cloning site Green=Tags(s) MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFE ELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEK DQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTA LSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEG STEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNE KQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKE QLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGE VLPDIDTLQIHVMDCII myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008212 |
| RefSeq Size | 3597 |
| RefSeq ORF | 1731 |
| Synonyms | ALS12; FIP2; GLC1E; HIP7; HYPL; NRP; TFIIIA-INTP |
| Locus ID | 10133 |
| Cytogenetics | 10p13 |
| Summary | This gene encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411824 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423390 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423391 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423392 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC425228 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425229 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411824 | Transient overexpression lysate of optineurin (OPTN), transcript variant 2 |
CNY 3080.00 |
|
| LY423390 | Transient overexpression lysate of optineurin (OPTN), transcript variant 1 |
CNY 3080.00 |
|
| LY423391 | Transient overexpression lysate of optineurin (OPTN), transcript variant 3 |
CNY 4840.00 |
|
| LY423392 | Transient overexpression lysate of optineurin (OPTN), transcript variant 4 |
CNY 4840.00 |
|
| LY425228 | Transient overexpression lysate of optineurin (OPTN), transcript variant 3 |
CNY 3080.00 |
|
| LY425229 | Transient overexpression lysate of optineurin (OPTN), transcript variant 4 |
CNY 3080.00 |
|
| TP302470 | Recombinant protein of human optineurin (OPTN), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Optineurin产品
