Optineurin (OPTN) (NM_001008211) Human Recombinant Protein
CAT#: TP302470
Recombinant protein of human optineurin (OPTN), transcript variant 1, 20 µg
View other "Optineurin" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202470 protein sequence
Red=Cloning site Green=Tags(s) MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFE ELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEK DQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTA LSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEG STEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNE KQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKE QLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGE VLPDIDTLQIHVMDCII myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001008212 |
| Locus ID | 10133 |
| UniProt ID | Q96CV9 |
| Refseq Size | 3597 |
| Cytogenetics | 10p13 |
| Refseq ORF | 1731 |
| Synonyms | ALS12; FIP2; GLC1E; HIP7; HYPL; NRP; TFIIIA-INTP |
| Summary | This gene encodes the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411824 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423390 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423391 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423392 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC425228 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425229 | OPTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411824 | Transient overexpression lysate of optineurin (OPTN), transcript variant 2 |
CNY 3080.00 |
|
| LY423390 | Transient overexpression lysate of optineurin (OPTN), transcript variant 1 |
CNY 3080.00 |
|
| LY423391 | Transient overexpression lysate of optineurin (OPTN), transcript variant 3 |
CNY 4840.00 |
|
| LY423392 | Transient overexpression lysate of optineurin (OPTN), transcript variant 4 |
CNY 4840.00 |
|
| LY425228 | Transient overexpression lysate of optineurin (OPTN), transcript variant 3 |
CNY 3080.00 |
|
| LY425229 | Transient overexpression lysate of optineurin (OPTN), transcript variant 4 |
CNY 3080.00 |
|
| PH302470 | OPTN MS Standard C13 and N15-labeled recombinant protein (NP_001008212) |
CNY 19520.00 |
其它Optineurin产品
