NME4 (NM_005009) Human Mass Spec Standard
CAT#: PH302603
NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000)
View other "NME4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202603 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC202603 protein sequence
Red=Cloning site Green=Tags(s) MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005000 |
RefSeq Size | 1059 |
RefSeq ORF | 561 |
Synonyms | NDPK-D; nm23-H4; NM23H4 |
Locus ID | 4833 |
Cytogenetics | 16p13.3 |
Summary | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401559 | NME4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401559 | Transient overexpression lysate of non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP302603 | Recombinant protein of human non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |