NME4 (NM_005009) Human Recombinant Protein
CAT#: TP302603
Recombinant protein of human non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein, 20 µg
View other "NME4" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC202603 protein sequence 
Red=Cloning site Green=Tags(s) MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 20.5 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_005000 | 
| Locus ID | 4833 | 
| UniProt ID | O00746 | 
| Refseq Size | 1059 | 
| Cytogenetics | 16p13.3 | 
| Refseq ORF | 561 | 
| Synonyms | NDPK-D; nm23-H4; NM23H4 | 
| Summary | The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401559 | NME4 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401559 | Transient overexpression lysate of non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein | 
                                                     CNY 3080.00  | 
                                            |
| PH302603 | NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000) | 
                                                     CNY 19520.00  | 
                                            
