SDOS (NUDT16L1) (NM_032349) Human Mass Spec Standard
CAT#: PH302638
NUDT16L1 MS Standard C13 and N15-labeled recombinant protein (NP_115725)
View other "SDOS" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NUDT16L1 MS Standard C13 and N15-labeled recombinant protein (NP_115725) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202638 |
| Predicted MW | 23.3 kDa |
| Protein Sequence |
>RC202638 protein sequence
Red=Cloning site Green=Tags(s) MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRR FWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVL GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPAS S myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115725 |
| RefSeq Size | 1367 |
| RefSeq ORF | 633 |
| Synonyms | SDOS; TIRR |
| Locus ID | 84309 |
| Cytogenetics | 16p13.3 |
| Summary | Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin (PubMed:28241136). In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus (PubMed:28241136). Following DNA damage, ATM-induced phosphorylation of TP53BP1 and subsequent recruitment of RIF1 leads to dissociate NUDT16L1/TIRR from TP53BP1, unmasking the tandem Tudor-like domain and allowing recruitment of TP53BP1 to DNA double strand breaks (DSBs) (PubMed:28241136). Binds U8 snoRNA (PubMed:18820299).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410186 | NUDT16L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434037 | NUDT16L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410186 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1) |
CNY 3080.00 |
|
| LY434037 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 2 |
CNY 3080.00 |
|
| TP302638 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), 20 µg |
CNY 2900.00 |
