SDOS (NUDT16L1) (NM_032349) Human Recombinant Protein
CAT#: TP302638
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), 20 µg
View other "SDOS" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202638 protein sequence
Red=Cloning site Green=Tags(s) MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRR FWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVL GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPAS S myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115725 |
Locus ID | 84309 |
UniProt ID | Q9BRJ7 |
Refseq Size | 1367 |
Cytogenetics | 16p13.3 |
Refseq ORF | 633 |
Synonyms | SDOS; TIRR |
Summary | Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin (PubMed:28241136). In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus (PubMed:28241136). Following DNA damage, ATM-induced phosphorylation of TP53BP1 and subsequent recruitment of RIF1 leads to dissociate NUDT16L1/TIRR from TP53BP1, unmasking the tandem Tudor-like domain and allowing recruitment of TP53BP1 to DNA double strand breaks (DSBs) (PubMed:28241136). Binds U8 snoRNA (PubMed:18820299).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410186 | NUDT16L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434037 | NUDT16L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410186 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1) |
CNY 3080.00 |
|
LY434037 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 2 |
CNY 3080.00 |
|
PH302638 | NUDT16L1 MS Standard C13 and N15-labeled recombinant protein (NP_115725) |
CNY 19520.00 |