PREI3 (MOB4) (NM_199482) Human Mass Spec Standard
CAT#: PH302689
MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_955776)
View other "PREI3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_955776) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202689 |
| Predicted MW | 22.1 kDa |
| Protein Sequence |
>RC202689 representing NM_199482
Red=Cloning site Green=Tags(s) MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWK YEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNK YFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI LEEEVQNSVSGESEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_955776 |
| RefSeq Size | 2698 |
| RefSeq ORF | 675 |
| Synonyms | 2C4D; CGI-95; MOB1; MOB3; MOBKL3; PHOCN; PREI3 |
| Locus ID | 25843 |
| Cytogenetics | 2q33.1 |
| Summary | This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.[provided by RefSeq, Feb 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402432 | MOB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404580 | MOB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402432 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1 |
CNY 3080.00 |
|
| LY404580 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2 |
CNY 3080.00 |
|
| PH313507 | MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_056202) |
CNY 14250.00 |
|
| TP302689 | Purified recombinant protein of Homo sapiens MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP313507 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720256 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 3 |
CNY 1800.00 |
