PREI3 (MOB4) (NM_199482) Human Recombinant Protein
CAT#: TP302689
Purified recombinant protein of Homo sapiens MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2, 20 µg
View other "PREI3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202689 representing NM_199482
Red=Cloning site Green=Tags(s) MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWK YEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNK YFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI LEEEVQNSVSGESEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_955776 |
| Locus ID | 25843 |
| UniProt ID | Q9Y3A3 |
| Refseq Size | 2698 |
| Cytogenetics | 2q33.1 |
| Refseq ORF | 675 |
| Synonyms | 2C4D; CGI-95; MOB1; MOB3; MOBKL3; PHOCN; PREI3 |
| Summary | This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.[provided by RefSeq, Feb 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402432 | MOB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404580 | MOB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402432 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1 |
CNY 3080.00 |
|
| LY404580 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 2 |
CNY 3080.00 |
|
| PH302689 | MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_955776) |
CNY 14250.00 |
|
| PH313507 | MOBKL3 MS Standard C13 and N15-labeled recombinant protein (NP_056202) |
CNY 14250.00 |
|
| TP313507 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720256 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 3 (yeast) (MOBKL3), transcript variant 3 |
CNY 1800.00 |
