Decorin (DCN) (NM_001920) Human Mass Spec Standard
CAT#: PH302753
DCN MS Standard C13 and N15-labeled recombinant protein (NP_001911)
View other "Decorin" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DCN MS Standard C13 and N15-labeled recombinant protein (NP_001911) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202753 |
Predicted MW | 39.7 kDa |
Protein Sequence |
>RC202753 protein sequence
Red=Cloning site Green=Tags(s) MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR SAIQLGNYK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001911 |
RefSeq Size | 2305 |
RefSeq ORF | 1077 |
Synonyms | CSCD; DSPG2; PG40; PGII; PGS2; SLRR1B |
Locus ID | 1634 |
Cytogenetics | 12q21.33 |
Summary | This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403339 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419655 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429085 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403339 | Transient overexpression lysate of decorin (DCN), transcript variant A2 |
CNY 3080.00 |
|
LY419655 | Transient overexpression lysate of decorin (DCN), transcript variant A1 |
CNY 3080.00 |
|
LY429085 | Transient overexpression lysate of decorin (DCN), transcript variant A1 |
CNY 3080.00 |
|
PH312223 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_598010) |
CNY 14250.00 |
|
PH318427 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_598013) |
CNY 19520.00 |
|
TP302753 | Recombinant protein of human decorin (DCN), transcript variant A1, 20 µg |
CNY 2900.00 |
|
TP312223 | Recombinant protein of human decorin (DCN), transcript variant A2, 20 µg |
CNY 2900.00 |
|
TP318427 | Recombinant protein of human decorin (DCN), transcript variant D, 20 µg |
CNY 2900.00 |
其它Decorin产品