Decorin (DCN) (NM_133503) Human Recombinant Protein
CAT#: TP312223
Recombinant protein of human decorin (DCN), transcript variant A2, 20 µg
View other "Decorin" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212223 protein sequence
Red=Cloning site Green=Tags(s) MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDL GLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQ LKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADT NITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNK LTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR SAIQLGNYK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_598010 |
| Locus ID | 1634 |
| UniProt ID | P07585 |
| Refseq Size | 2151 |
| Cytogenetics | 12q21.33 |
| Refseq ORF | 1077 |
| Synonyms | CSCD; DSPG2; PG40; PGII; PGS2; SLRR1B |
| Summary | This gene encodes a member of the small leucine-rich proteoglycan family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. This protein plays a role in collagen fibril assembly. Binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. This gene and the related gene biglycan are thought to be the result of a gene duplication. Mutations in this gene are associated with congenital stromal corneal dystrophy in human patients. [provided by RefSeq, Nov 2015] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403339 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419655 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429085 | DCN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403339 | Transient overexpression lysate of decorin (DCN), transcript variant A2 |
CNY 3080.00 |
|
| LY419655 | Transient overexpression lysate of decorin (DCN), transcript variant A1 |
CNY 3080.00 |
|
| LY429085 | Transient overexpression lysate of decorin (DCN), transcript variant A1 |
CNY 3080.00 |
|
| PH302753 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_001911) |
CNY 19520.00 |
|
| PH312223 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_598010) |
CNY 14250.00 |
|
| PH318427 | DCN MS Standard C13 and N15-labeled recombinant protein (NP_598013) |
CNY 19520.00 |
|
| TP302753 | Recombinant protein of human decorin (DCN), transcript variant A1, 20 µg |
CNY 2900.00 |
|
| TP318427 | Recombinant protein of human decorin (DCN), transcript variant D, 20 µg |
CNY 2900.00 |
其它Decorin产品
