NQO2 (NM_000904) Human Mass Spec Standard
CAT#: PH302889
NQO2 MS Standard C13 and N15-labeled recombinant protein (NP_000895)
View other "NQO2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NQO2 MS Standard C13 and N15-labeled recombinant protein (NP_000895) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202889 |
| Predicted MW | 26 kDa |
| Protein Sequence |
>RC202889 protein sequence
Red=Cloning site Green=Tags(s) MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNPEVFNYGV ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ RLQTIWKEEPIPCTAHWHFGQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000895 |
| RefSeq Size | 1272 |
| RefSeq ORF | 693 |
| Synonyms | DHQV; DIA6; NMOR2; QR2 |
| Locus ID | 4835 |
| Cytogenetics | 6p25.2 |
| Summary | This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424463 | NQO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424463 | Transient overexpression lysate of NAD(P)H dehydrogenase, quinone 2 (NQO2) |
CNY 3080.00 |
|
| TP302889 | Recombinant protein of human NAD(P)H dehydrogenase, quinone 2 (NQO2), 20 µg |
CNY 2900.00 |
