NQO2 (NM_000904) Human Recombinant Protein
CAT#: TP302889
Recombinant protein of human NAD(P)H dehydrogenase, quinone 2 (NQO2), 20 µg
View other "NQO2" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC202889 protein sequence 
Red=Cloning site Green=Tags(s) MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNPEVFNYGV ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ RLQTIWKEEPIPCTAHWHFGQ myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 25.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_000895 | 
| Locus ID | 4835 | 
| UniProt ID | P16083 | 
| Refseq Size | 1272 | 
| Cytogenetics | 6p25.2 | 
| Refseq ORF | 693 | 
| Synonyms | DHQV; DIA6; NMOR2; QR2 | 
| Summary | This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Reduction and Scavenging of Chemically Reactive Drug Metabolites by NAD(P)H:Quinone Oxidoreductase 1 and NRH:Quinone Oxidoreductase 2 and Variability in Hepatic Concentrations
                                                ,null,
                                                Chemical Research in Toxicology
                                                ,PubMed ID 29281794
                                                [NQO2]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC424463 | NQO2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY424463 | Transient overexpression lysate of NAD(P)H dehydrogenase, quinone 2 (NQO2) | 
                                                     CNY 3080.00  | 
                                            |
| PH302889 | NQO2 MS Standard C13 and N15-labeled recombinant protein (NP_000895) | 
                                                     CNY 19520.00  | 
                                            
