HOXA10 (NM_018951) Human Mass Spec Standard
CAT#: PH302939
HOXA10 MS Standard C13 and N15-labeled recombinant protein (NP_061824)
View other "HOXA10" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HOXA10 MS Standard C13 and N15-labeled recombinant protein (NP_061824) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202939 |
Predicted MW | 40.5 kDa |
Protein Sequence |
>RC202939 protein sequence
Red=Cloning site Green=Tags(s) MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGK RNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSC SFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYG SGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSS AAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL EISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061824 |
RefSeq Size | 2648 |
RefSeq ORF | 1179 |
Synonyms | HOX1; HOX1.8; HOX1H; PL |
Locus ID | 3206 |
Cytogenetics | 7p15.2 |
Summary | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene. [provided by RefSeq, Mar 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402717 | HOXA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432224 | HOXA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402717 | Transient overexpression lysate of homeobox A10 (HOXA10), transcript variant 1 |
CNY 3080.00 |
|
LY432224 | Transient overexpression lysate of homeobox A10 (HOXA10), transcript variant 1 |
CNY 3080.00 |
|
TP302939 | Recombinant protein of human homeobox A10 (HOXA10), transcript variant 1, 20 µg |
CNY 2900.00 |