HOXA10 (NM_018951) Human Recombinant Protein
CAT#: TP302939
Recombinant protein of human homeobox A10 (HOXA10), transcript variant 1, 20 µg
View other "HOXA10" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202939 protein sequence
Red=Cloning site Green=Tags(s) MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPPAADLPYGLQSCGLFPTLGGK RNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLDAPRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSC SFAQNIKEESSYCLYDSADKCPKVSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYG SGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSS AAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL EISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061824 |
Locus ID | 3206 |
UniProt ID | P31260 |
Refseq Size | 2648 |
Cytogenetics | 7p15.2 |
Refseq ORF | 1179 |
Synonyms | HOX1; HOX1.8; HOX1H; PL |
Summary | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the downstream homeobox A9 (HOXA9) gene. [provided by RefSeq, Mar 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402717 | HOXA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432224 | HOXA10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402717 | Transient overexpression lysate of homeobox A10 (HOXA10), transcript variant 1 |
CNY 3080.00 |
|
LY432224 | Transient overexpression lysate of homeobox A10 (HOXA10), transcript variant 1 |
CNY 3080.00 |
|
PH302939 | HOXA10 MS Standard C13 and N15-labeled recombinant protein (NP_061824) |
CNY 19520.00 |