TRNT1 (NM_016000) Human Mass Spec Standard
CAT#: PH303043
TRNT1 MS Standard C13 and N15-labeled recombinant protein (NP_057084)
View other "TRNT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TRNT1 MS Standard C13 and N15-labeled recombinant protein (NP_057084) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203043 |
| Predicted MW | 46.4 kDa |
| Protein Sequence |
>RC203043 protein sequence
Red=Cloning site Green=Tags(s) MKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIR MINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDY FNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIW VELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKL DLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQ QWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057084 |
| RefSeq Size | 1864 |
| RefSeq ORF | 1215 |
| Synonyms | CCA1; CCA1, MtCCA, CGI-47; CGI-47; mitochondrial CCA-adding tRNA-nucleotidyltransferase; MtCCA; tRNA nucleotidyl transferase, CCA-adding, 1 |
| Locus ID | 51095 |
| Cytogenetics | 3p26.2 |
| Summary | The protein encoded by this gene is a CCA-adding enzyme which belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. This essential enzyme functions by catalyzing the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules. Mutations in this gene result in sideroblastic anemia with B-cell immunodeficiency, periodic fevers, and developmental delay. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414245 | TRNT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414245 | Transient overexpression lysate of tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1), transcript variant 1 |
CNY 3080.00 |
|
| TP303043 | Recombinant protein of human tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1), transcript variant 1, 20 µg |
CNY 2900.00 |
