BCCIP (NM_078468) Human Mass Spec Standard
CAT#: PH303061
BCCIP MS Standard C13 and N15-labeled recombinant protein (NP_510868)
View other "BCCIP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BCCIP MS Standard C13 and N15-labeled recombinant protein (NP_510868) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203061 |
| Predicted MW | 36.1 kDa |
| Protein Sequence |
>RC203061 protein sequence
Red=Cloning site Green=Tags(s) MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN KPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_510868 |
| RefSeq Size | 1261 |
| RefSeq ORF | 942 |
| Synonyms | TOK-1; TOK1 |
| Locus ID | 56647 |
| Cytogenetics | 10q26.2 |
| Summary | This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409214 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409215 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413842 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409214 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B |
CNY 3080.00 |
|
| LY409215 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant C |
CNY 3080.00 |
|
| LY413842 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant A |
CNY 3080.00 |
|
| TP303061 | Recombinant protein of human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B, 20 µg |
CNY 2900.00 |
