BCCIP (NM_078468) Human Recombinant Protein
CAT＃: TP303061
Recombinant protein of human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B, 20 µg
View other "BCCIP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
Product images
CNY 6281.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203061 protein sequence
Red=Cloning site Green=Tags(s) MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN KPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_510868 |
| Locus ID | 56647 |
| UniProt ID | Q9P287 |
| Refseq Size | 1261 |
| Cytogenetics | 10q26.2 |
| Refseq ORF | 942 |
| Synonyms | TOK-1; TOK1 |
| Summary | This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Efficient embryonic homozygous gene conversion via RAD51-enhanced interhomolog repair
,Wilde, JJ;Aida, T;Del Rosario, RCH;Kaiser, T;Qi, P;Wienisch, M;Zhang, Q;Colvin, S;Feng, G;,
Cell
,PubMed ID 34043941
[BCCIP]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409214 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409215 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413842 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409214 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B |
CNY 3080.00 |
|
| LY409215 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant C |
CNY 3080.00 |
|
| LY413842 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant A |
CNY 3080.00 |
|
| PH303061 | BCCIP MS Standard C13 and N15-labeled recombinant protein (NP_510868) |
CNY 19520.00 |
