C3Orf34 (CEP19) (NM_032898) Human Mass Spec Standard
CAT#: PH303186
C3orf34 MS Standard C13 and N15-labeled recombinant protein (NP_116287)
View other "C3Orf34" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | C3orf34 MS Standard C13 and N15-labeled recombinant protein (NP_116287) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203186 |
Predicted MW | 19.2 kDa |
Protein Sequence |
>RC203186 protein sequence
Red=Cloning site Green=Tags(s) MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQL EKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDI EVEFPQDDQLQSCGWDTESADEF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116287 |
RefSeq Size | 2216 |
RefSeq ORF | 489 |
Synonyms | C3orf34; MOSPGF |
Locus ID | 84984 |
Cytogenetics | 3q29 |
Summary | The protein encoded by this gene localizes to centrosomes and primary cilia and co-localizes with a marker for the mother centriole. This gene resides in a region of human chromosome 3 that is linked to morbid obesity. A homozygous knockout of the orthologous gene in mouse resulted in mice with morbid obesity, hyperphagy, glucose intolerance, and insulin resistance. Mutations in this gene cause morbid obesity and spermatogenic failure (MOSPGF). This gene has a pseudogene on human chromosome 2. [provided by RefSeq, Apr 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409860 | CEP19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409860 | Transient overexpression lysate of chromosome 3 open reading frame 34 (C3orf34) |
CNY 3080.00 |
|
TP303186 | Recombinant protein of human chromosome 3 open reading frame 34 (C3orf34), 20 µg |
CNY 2900.00 |
其它C3Orf34产品