C3Orf34 (CEP19) (NM_032898) Human Recombinant Protein
CAT#: TP303186
Recombinant protein of human chromosome 3 open reading frame 34 (C3orf34), 20 µg
View other "C3Orf34" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203186 protein sequence
Red=Cloning site Green=Tags(s) MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQL EKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDI EVEFPQDDQLQSCGWDTESADEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116287 |
Locus ID | 84984 |
UniProt ID | Q96LK0 |
Refseq Size | 2216 |
Cytogenetics | 3q29 |
Refseq ORF | 489 |
Synonyms | C3orf34; MOSPGF |
Summary | The protein encoded by this gene localizes to centrosomes and primary cilia and co-localizes with a marker for the mother centriole. This gene resides in a region of human chromosome 3 that is linked to morbid obesity. A homozygous knockout of the orthologous gene in mouse resulted in mice with morbid obesity, hyperphagy, glucose intolerance, and insulin resistance. Mutations in this gene cause morbid obesity and spermatogenic failure (MOSPGF). This gene has a pseudogene on human chromosome 2. [provided by RefSeq, Apr 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409860 | CEP19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409860 | Transient overexpression lysate of chromosome 3 open reading frame 34 (C3orf34) |
CNY 3080.00 |
|
PH303186 | C3orf34 MS Standard C13 and N15-labeled recombinant protein (NP_116287) |
CNY 19520.00 |
其它C3Orf34产品