Cyclophilin A (PPIA) (NM_021130) Human Mass Spec Standard
CAT#: PH303307
PPIA MS Standard C13 and N15-labeled recombinant protein (NP_066953)
View other "Cyclophilin A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PPIA MS Standard C13 and N15-labeled recombinant protein (NP_066953) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203307 |
| Predicted MW | 18 kDa |
| Protein Sequence |
>RC203307 protein sequence
Red=Cloning site Green=Tags(s) MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH NGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE AMERFGSRNGKTSKKITIADCGQLE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066953 |
| RefSeq Size | 2288 |
| RefSeq ORF | 495 |
| Synonyms | CYPA; CYPH; HEL-S-69p |
| Locus ID | 5478 |
| Cytogenetics | 7p13 |
| Summary | This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402839 | PPIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402839 | Transient overexpression lysate of peptidylprolyl isomerase A (cyclophilin A) (PPIA) |
CNY 3080.00 |
|
| TP303307 | Recombinant protein of human peptidylprolyl isomerase A (cyclophilin A) (PPIA), 20 µg |
CNY 2900.00 |
其它Cyclophilin A产品
