Cyclophilin A (PPIA) (NM_021130) Human Recombinant Protein
CAT#: TP303307
Recombinant protein of human peptidylprolyl isomerase A (cyclophilin A) (PPIA), 20 µg
View other "Cyclophilin A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203307 protein sequence
Red=Cloning site Green=Tags(s) MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH NGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE AMERFGSRNGKTSKKITIADCGQLE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066953 |
| Locus ID | 5478 |
| UniProt ID | P62937 |
| Refseq Size | 2288 |
| Cytogenetics | 7p13 |
| Refseq ORF | 495 |
| Synonyms | CYPA; CYPH; HEL-S-69p |
| Summary | This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq, Jul 2008] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Cyclosporine A binding to COX-2 reveals a novel signaling pathway that activates the IRE1α unfolded protein response sensor
,Groenendyk, J;Paskevicius, T;Urra, H;Viricel, C;Wang, K;Barakat, K;Hetz, C;Kurgan, L;Agellon, LB;Michalak, M;,
Sci Rep
,PubMed ID 30420769
[PPIA]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402839 | PPIA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402839 | Transient overexpression lysate of peptidylprolyl isomerase A (cyclophilin A) (PPIA) |
CNY 3080.00 |
|
| PH303307 | PPIA MS Standard C13 and N15-labeled recombinant protein (NP_066953) |
CNY 19520.00 |
其它Cyclophilin A产品
