SLD5 (GINS4) (NM_032336) Human Mass Spec Standard
CAT#: PH303336
GINS4 MS Standard C13 and N15-labeled recombinant protein (NP_115712)
View other "SLD5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GINS4 MS Standard C13 and N15-labeled recombinant protein (NP_115712) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203336 |
| Predicted MW | 26 kDa |
| Protein Sequence |
>RC203336 protein sequence
Red=Cloning site Green=Tags(s) MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT IAPLVASGAVQLI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115712 |
| RefSeq Size | 3841 |
| RefSeq ORF | 669 |
| Synonyms | SLD5 |
| Locus ID | 84296 |
| Cytogenetics | 8p11.21 |
| Summary | The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403156 | GINS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403156 | Transient overexpression lysate of GINS complex subunit 4 (Sld5 homolog) (GINS4) |
CNY 3080.00 |
|
| TP303336 | Recombinant protein of human GINS complex subunit 4 (Sld5 homolog) (GINS4), 20 µg |
CNY 2900.00 |
