HIP55 (DBNL) (NM_014063) Human Mass Spec Standard
CAT#: PH303435
DBNL MS Standard C13 and N15-labeled recombinant protein (NP_054782)
View other "HIP55" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | DBNL MS Standard C13 and N15-labeled recombinant protein (NP_054782) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203435 |
| Predicted MW | 48.3 kDa |
| Protein Sequence |
>RC203435 protein sequence
Red=Cloning site Green=Tags(s) MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR ERELREAARREQRYQEQGGEASPQSRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPG KLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPL VQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFG MFPANYVELIE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_054782 |
| RefSeq Size | 2213 |
| RefSeq ORF | 1293 |
| Synonyms | ABP1; HIP-55; HIP55; SH3P7 |
| Locus ID | 28988 |
| Cytogenetics | 7p13 |
| Summary | Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and synapse formation via its interaction with WASL and COBL. Does not bind G-actin and promote actin polymerization by itself. Required for the formation of organized podosome rosettes (By similarity). May act as a common effector of antigen receptor-signaling pathways in leukocytes. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402274 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423061 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426586 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402274 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 1 |
CNY 3080.00 |
|
| LY423061 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 2 |
CNY 4840.00 |
|
| LY426586 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 3 |
CNY 3080.00 |
|
| PH323992 | DBNL MS Standard C13 and N15-labeled recombinant protein (NP_001014436) |
CNY 19520.00 |
|
| TP303435 | Recombinant protein of human drebrin-like (DBNL), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP323992 | Recombinant protein of human drebrin-like (DBNL), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP710145 | Recombinant protein of human drebrin-like (DBNL), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
