HIP55 (DBNL) (NM_014063) Human Recombinant Protein
CAT#: TP303435
Recombinant protein of human drebrin-like (DBNL), transcript variant 1, 20 µg
View other "HIP55" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203435 protein sequence
Red=Cloning site Green=Tags(s) MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR ERELREAARREQRYQEQGGEASPQSRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPG KLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPL VQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFG MFPANYVELIE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054782 |
| Locus ID | 28988 |
| UniProt ID | Q9UJU6 |
| Refseq Size | 2213 |
| Cytogenetics | 7p13 |
| Refseq ORF | 1293 |
| Synonyms | ABP1; HIP-55; HIP55; SH3P7 |
| Summary | Adapter protein that binds F-actin and DNM1, and thereby plays a role in receptor-mediated endocytosis. Plays a role in the reorganization of the actin cytoskeleton, formation of cell projections, such as neurites, in neuron morphogenesis and synapse formation via its interaction with WASL and COBL. Does not bind G-actin and promote actin polymerization by itself. Required for the formation of organized podosome rosettes (By similarity). May act as a common effector of antigen receptor-signaling pathways in leukocytes. Acts as a key component of the immunological synapse that regulates T-cell activation by bridging TCRs and the actin cytoskeleton to gene activation and endocytic processes.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402274 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423061 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426586 | DBNL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402274 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 1 |
CNY 3080.00 |
|
| LY423061 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 2 |
CNY 4840.00 |
|
| LY426586 | Transient overexpression lysate of drebrin-like (DBNL), transcript variant 3 |
CNY 3080.00 |
|
| PH303435 | DBNL MS Standard C13 and N15-labeled recombinant protein (NP_054782) |
CNY 19520.00 |
|
| PH323992 | DBNL MS Standard C13 and N15-labeled recombinant protein (NP_001014436) |
CNY 19520.00 |
|
| TP323992 | Recombinant protein of human drebrin-like (DBNL), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP710145 | Recombinant protein of human drebrin-like (DBNL), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
