p38 (CRK) (NM_005206) Human Mass Spec Standard
CAT#: PH303438
CRK MS Standard C13 and N15-labeled recombinant protein (NP_005197)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CRK MS Standard C13 and N15-labeled recombinant protein (NP_005197) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203438 |
| Predicted MW | 22.9 kDa |
| Protein Sequence |
>RC203438 protein sequence
Red=Cloning site Green=Tags(s) MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005197 |
| RefSeq Size | 3055 |
| RefSeq ORF | 612 |
| Synonyms | CRKII; p38 |
| Locus ID | 1398 |
| Cytogenetics | 17p13.3 |
| Summary | This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402580 | CRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417443 | CRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402580 | Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II |
CNY 3080.00 |
|
| LY417443 | Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I |
CNY 3080.00 |
|
| PH301701 | CRK MS Standard C13 and N15-labeled recombinant protein (NP_058431) |
CNY 19520.00 |
|
| TP301701 | Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II, 20 µg |
CNY 2900.00 |
|
| TP303438 | Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I, 20 µg |
CNY 2900.00 |
