p38 (CRK) (NM_016823) Human Recombinant Protein
CAT#: TP301701
Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201701 protein sequence
Red=Cloning site Green=Tags(s) MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHP QPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECN GKRGHFPFTHVRLLDQQNPDEDFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_058431 |
| Locus ID | 1398 |
| UniProt ID | P46108 |
| Refseq Size | 3225 |
| Cytogenetics | 17p13.3 |
| Refseq ORF | 912 |
| Synonyms | CRKII; p38 |
| Summary | This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402580 | CRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417443 | CRK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402580 | Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant II |
CNY 3080.00 |
|
| LY417443 | Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I |
CNY 3080.00 |
|
| PH301701 | CRK MS Standard C13 and N15-labeled recombinant protein (NP_058431) |
CNY 19520.00 |
|
| PH303438 | CRK MS Standard C13 and N15-labeled recombinant protein (NP_005197) |
CNY 19520.00 |
|
| TP303438 | Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian) (CRK), transcript variant I, 20 µg |
CNY 2900.00 |
