ARL3 (NM_004311) Human Mass Spec Standard
CAT#: PH303469
ARL3 MS Standard C13 and N15-labeled recombinant protein (NP_004302)
View other "ARL3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ARL3 MS Standard C13 and N15-labeled recombinant protein (NP_004302) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203469 |
| Predicted MW | 20.5 kDa |
| Protein Sequence |
>RC203469 protein sequence
Red=Cloning site Green=Tags(s) MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGG QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIA EGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004302 |
| RefSeq Size | 3891 |
| RefSeq ORF | 546 |
| Synonyms | ARFL3; JBTS35; RP83 |
| Locus ID | 403 |
| Cytogenetics | 10q24.32 |
| Summary | ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418068 | ARL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418068 | Transient overexpression lysate of ADP-ribosylation factor-like 3 (ARL3) |
CNY 3080.00 |
|
| TP303469 | Recombinant protein of human ADP-ribosylation factor-like 3 (ARL3), 20 µg |
CNY 2900.00 |
