ARL3 (NM_004311) Human Recombinant Protein
CAT#: TP303469
Recombinant protein of human ADP-ribosylation factor-like 3 (ARL3), 20 µg
View other "ARL3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203469 protein sequence
Red=Cloning site Green=Tags(s) MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGG QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIA EGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 20.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004302 |
| Locus ID | 403 |
| UniProt ID | P36405 |
| Refseq Size | 3891 |
| Cytogenetics | 10q24.32 |
| Refseq ORF | 546 |
| Synonyms | ARFL3; JBTS35; RP83 |
| Summary | ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418068 | ARL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418068 | Transient overexpression lysate of ADP-ribosylation factor-like 3 (ARL3) |
CNY 3080.00 |
|
| PH303469 | ARL3 MS Standard C13 and N15-labeled recombinant protein (NP_004302) |
CNY 19520.00 |
