FAM3A (NM_021806) Human Mass Spec Standard
CAT#: PH303495
FAM3A MS Standard C13 and N15-labeled recombinant protein (NP_068578)
View other "FAM3A" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FAM3A MS Standard C13 and N15-labeled recombinant protein (NP_068578) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203495 |
| Predicted MW | 25.2 kDa |
| Protein Sequence |
>RC203495 protein sequence
Red=Cloning site Green=Tags(s) MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY EGWPEALEMEGCIPRRSTAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068578 |
| RefSeq Size | 1821 |
| RefSeq ORF | 690 |
| Synonyms | 2.19; DLD; DXS560S; XAP-7 |
| Locus ID | 60343 |
| Cytogenetics | Xq28 |
| Summary | This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411913 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432664 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411913 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 1 |
CNY 3080.00 |
|
| LY432664 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 3 |
CNY 3080.00 |
|
| TP303495 | Recombinant protein of human family with sequence similarity 3, member A (FAM3A), 20 µg |
CNY 2900.00 |
|
| TP329664 | Purified recombinant protein of Homo sapiens family with sequence similarity 3, member A (FAM3A), transcript variant 3, 20 µg |
CNY 2900.00 |


