FAM3A (NM_021806) Human Mass Spec Standard
CAT#: PH303495
FAM3A MS Standard C13 and N15-labeled recombinant protein (NP_068578)
View other "FAM3A" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FAM3A MS Standard C13 and N15-labeled recombinant protein (NP_068578) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203495 |
Predicted MW | 25.2 kDa |
Protein Sequence |
>RC203495 protein sequence
Red=Cloning site Green=Tags(s) MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY EGWPEALEMEGCIPRRSTAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068578 |
RefSeq Size | 1821 |
RefSeq ORF | 690 |
Synonyms | 2.19; DLD; DXS560S; XAP-7 |
Locus ID | 60343 |
Cytogenetics | Xq28 |
Summary | This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411913 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432664 | FAM3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411913 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 1 |
CNY 3080.00 |
|
LY432664 | Transient overexpression lysate of family with sequence similarity 3, member A (FAM3A), transcript variant 3 |
CNY 3080.00 |
|
TP303495 | Recombinant protein of human family with sequence similarity 3, member A (FAM3A), 20 µg |
CNY 2900.00 |
|
TP329664 | Purified recombinant protein of Homo sapiens family with sequence similarity 3, member A (FAM3A), transcript variant 3, 20 µg |
CNY 2900.00 |